Loading...
Statistics
Advertisement

Carol's Shore Cuts
www.carolshorecuts.com/

Carolshorecuts.com

Advertisement
Conversion Technology Metas Server
Carolshorecuts.com is hosted in United States / Los Angeles . Carolshorecuts.com uses HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Html, Html5, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache. Its CMS is: Wordpress.

Technologies in use by Carolshorecuts.com

Technology

Number of occurences: 6
  • CSS
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback

Advertisement

Content Management System

Number of occurences: 1
  • Wordpress

Server Type

  • Apache

Powered by

  • PHP/5.3.29

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Carolshorecuts.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=PositiveSSL Wildcard/CN=*.web-hosting.com
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: PositiveSSL Wildcard
      • CN: *.web-hosting.com
    • hash: 9bd6b563
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 327078694229231257136179457599941650990
    • validFrom: 150204000000Z
    • validTo: 180307235959Z
    • validFrom_time_t: 1423008000
    • validTo_time_t: 1520467199
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: C3:55:63:79:8D:C2:19:7D:7C:33:8A:4F:A9:6D:53:40:E3:66:56:7C
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.web-hosting.com, DNS:web-hosting.com

Meta - Carolshorecuts.com

Number of occurences: 2
  • Name:
    Content: text/html; charset=UTF-8
  • Name: generator
    Content: WordPress 4.2.7

Server / Hosting

  • IP: 199.188.205.67
  • Latitude: 34.04
  • Longitude: -118.43
  • Country: United States
  • City: Los Angeles

Rname

  • dns1.namecheaphosting.com
  • dns2.namecheaphosting.com
  • smx2.web-hosting.com
  • smx4.web-hosting.com

Target

  • hosting-notifications.namecheaphosting.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Date: Sun, 10 Apr 2016 00:36:54 GMT Server: Apache X-Powered-By: PHP/5.3.29 X-Pingback: http://www.carolshorecuts.com/xmlrpc.php Location: http://www.carolshorecuts.com/ Content-Type: text/html; charset=UTF-8 HTTP/1.1 200 OK Date: Sun, 10 Apr 2016 00:36:55 GMT Server: Apache X-Powered-By: PHP/5.3.29 X-Pingback: http://www.carolshorecuts.com/xmlrpc.php Link: ; rel=shortlink Content-Type: text/html; charset=UTF-8

DNS

host: carolshorecuts.com
  1. class: IN
  2. ttl: 1198
  3. type: A
  4. ip: 199.188.205.67
host: carolshorecuts.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: dns1.namecheaphosting.com
host: carolshorecuts.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: dns2.namecheaphosting.com
host: carolshorecuts.com
  1. class: IN
  2. ttl: 1800000
  3. type: SOA
  4. mname: dns1.namecheaphosting.com
  5. rname: hosting-notifications.namecheaphosting.com
  6. serial: 2015122700
  7. refresh: 86400
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 86400
host: carolshorecuts.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 20
  5. target: smx2.web-hosting.com
host: carolshorecuts.com
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: smx4.web-hosting.com
host: carolshorecuts.com
  1. class: IN
  2. ttl: 14400
  3. type: TXT
  4. txt: v=spf1 include:spf.efwd.registrar-servers.com +a +mx
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.arolshorecuts.com, www.cdarolshorecuts.com, www.darolshorecuts.com, www.crarolshorecuts.com, www.rarolshorecuts.com, www.ctarolshorecuts.com, www.tarolshorecuts.com, www.cvarolshorecuts.com, www.varolshorecuts.com, www.cfarolshorecuts.com, www.farolshorecuts.com, www.cgarolshorecuts.com, www.garolshorecuts.com, www.charolshorecuts.com, www.harolshorecuts.com, www.cnarolshorecuts.com, www.narolshorecuts.com, www.cmarolshorecuts.com, www.marolshorecuts.com, www.cjarolshorecuts.com, www.jarolshorecuts.com, www.crolshorecuts.com, www.caorolshorecuts.com, www.corolshorecuts.com, www.caprolshorecuts.com, www.cprolshorecuts.com, www.ca9rolshorecuts.com, www.c9rolshorecuts.com, www.carolshorecuts.com, www.crolshorecuts.com, www.cairolshorecuts.com, www.cirolshorecuts.com, www.caurolshorecuts.com, www.curolshorecuts.com, www.caolshorecuts.com, www.cariolshorecuts.com, www.caiolshorecuts.com, www.caroolshorecuts.com, www.caoolshorecuts.com, www.carlolshorecuts.com, www.calolshorecuts.com, www.carlolshorecuts.com, www.calolshorecuts.com, www.car.olshorecuts.com, www.ca.olshorecuts.com, www.carlshorecuts.com, www.caroblshorecuts.com, www.carblshorecuts.com, www.carohlshorecuts.com, www.carhlshorecuts.com, www.caroglshorecuts.com, www.carglshorecuts.com, www.carojlshorecuts.com, www.carjlshorecuts.com, www.caromlshorecuts.com, www.carmlshorecuts.com, www.caro lshorecuts.com, www.car lshorecuts.com, www.carovlshorecuts.com, www.carvlshorecuts.com, www.caroshorecuts.com, www.carolushorecuts.com, www.caroushorecuts.com, www.carol8shorecuts.com, www.caro8shorecuts.com, www.carol9shorecuts.com, www.caro9shorecuts.com, www.caroljshorecuts.com, www.carojshorecuts.com, www.carol0shorecuts.com, www.caro0shorecuts.com, www.carolmshorecuts.com, www.caromshorecuts.com, www.carolpshorecuts.com, www.caropshorecuts.com, www.caroloshorecuts.com, www.carooshorecuts.com, www.carolhorecuts.com, www.carolsehorecuts.com, www.carolehorecuts.com, www.carolsdhorecuts.com, www.caroldhorecuts.com, www.carolsxhorecuts.com, www.carolxhorecuts.com, www.carolsfhorecuts.com, www.carolfhorecuts.com, www.carolsghorecuts.com, www.carolghorecuts.com, www.carolsthorecuts.com, www.carolthorecuts.com, www.carolsorecuts.com, www.carolsheorecuts.com, www.carolseorecuts.com, www.carolshdorecuts.com, www.carolsdorecuts.com, www.carolshcorecuts.com, www.carolscorecuts.com, www.carolshuorecuts.com, www.carolsuorecuts.com, www.carolshjorecuts.com, www.carolsjorecuts.com, www.carolshorecuts.com, www.carolsorecuts.com, www.carolshborecuts.com, www.carolsborecuts.com, www.carolshgorecuts.com, www.carolsgorecuts.com, www.carolshrecuts.com, www.carolshobrecuts.com, www.carolshbrecuts.com, www.carolshohrecuts.com, www.carolshhrecuts.com, www.carolshogrecuts.com, www.carolshgrecuts.com, www.carolshojrecuts.com, www.carolshjrecuts.com, www.carolshomrecuts.com, www.carolshmrecuts.com, www.carolsho recuts.com, www.carolsh recuts.com, www.carolshovrecuts.com, www.carolshvrecuts.com, www.carolshoecuts.com, www.carolshoriecuts.com, www.carolshoiecuts.com, www.carolshoroecuts.com, www.carolshooecuts.com, www.carolshorlecuts.com, www.carolsholecuts.com, www.carolshorlecuts.com, www.carolsholecuts.com, www.carolshor.ecuts.com, www.carolsho.ecuts.com, www.carolshorcuts.com, www.carolshorexcuts.com, www.carolshorxcuts.com, www.carolshorescuts.com, www.carolshorscuts.com, www.carolshorewcuts.com, www.carolshorwcuts.com, www.carolshorercuts.com, www.carolshorrcuts.com, www.carolshorefcuts.com, www.carolshorfcuts.com, www.carolshorevcuts.com, www.carolshorvcuts.com, www.carolshoreccuts.com, www.carolshorccuts.com, www.carolshoreqcuts.com, www.carolshorqcuts.com, www.carolshoreacuts.com, www.carolshoracuts.com, www.carolshoreycuts.com, www.carolshorycuts.com, www.carolshoreuts.com, www.carolshorecduts.com, www.carolshoreduts.com, www.carolshorecruts.com, www.carolshoreruts.com, www.carolshorectuts.com, www.carolshoretuts.com, www.carolshorecvuts.com, www.carolshorevuts.com, www.carolshorecfuts.com, www.carolshorefuts.com, www.carolshorecguts.com, www.carolshoreguts.com, www.carolshorechuts.com, www.carolshorehuts.com, www.carolshorecnuts.com, www.carolshorenuts.com, www.carolshorecmuts.com, www.carolshoremuts.com, www.carolshorecjuts.com, www.carolshorejuts.com,

Other websites we recently analyzed

  1. Welcome to Doha Careers - Qatar's Premium Job Portal
    Singapore - 203.124.115.1
    G Analytics ID: UA-42408050-1
    Server software: Apache
    Technology: Google Adsense, CSS, Html, Iframe, Javascript, jQuery, Php, Google Analytics
    Number of Javascript: 6
    Number of meta tags: 2
  2. casact.info
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  3. www.spacialsearch.com
    Sunnyvale (United States) - 98.139.135.128
    Server software: ATS/5.0.1
    Technology: CSS, Html
    Number of meta tags: 2
  4. www.waterfrontcitiesoftheworld.tv
    Scottsdale (United States) - 50.63.202.15
    Server software: Microsoft-IIS/7.5
    Technology: Html
  5. Trolleys - Buy hand trolleys & more | Ento, Australia
    We manufacture a wide range of quality trolleys & material handling equipment, and deliver Australia-wide. Call us today to find out more!
    Australia - 203.19.243.91
    G Analytics ID: UA-51455893-1
    Server software: Microsoft-IIS/7.5
    Technology: Html, Javascript, Php, Google Analytics
    Number of meta tags: 9
  6. mississippicriminaldefensetriallawyer.com
    Scottsdale (United States) - 50.63.202.34
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  7. ekybupyn.xyz
    San Francisco (United States) - 104.27.165.181
    Server software: cloudflare-nginx
    Technology: Html
  8. Home
    Scottsdale (United States) - 160.153.136.3
    Server software: DPS/1.0.6
    Technology: CSS, Html, Html5, Javascript
    Number of Javascript: 1
    Number of meta tags: 2
  9. groenlandiafilm.com
    Italy - 195.110.124.188
    Server software: Apache
    Technology: Html
  10. Mobili e arredi - Broni - Pavia - Mobili Arredamenti Tacci
    Mobili Arredamenti Tacci a Broni in provincia di Pavia è un negozio di arredamento che propone arredi e mobili delle migliori marche del settore a prezzi competitivi
    Milan (Italy) - 212.48.12.143
    Server software: Apache/2.2.22 (Ubuntu)
    Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery Cookie, jQuery Fancybox, jQuery UI, Php, SiteCatalyst
    Number of Javascript: 45
    Number of meta tags: 5

Check Other Websites